FAM83D Rabbit Polyclonal Antibody

SKU TA335440

Rabbit Polyclonal Anti-FAM83D Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FAM83D Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM83D. Synthetic peptide located within the following region: HFQSSNKFDHLTNRKPQSKELTLGNLLRMRLARLSSTPRKADLDPEMPAE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 67 kDa
• Gene Name: family with sequence similarity 83 member D
• Database Link:
  NP_112181
  Q9H4H8
• Background: FAM83D is required for proper chromosome congression and alignment during mitosis and is required for targeting KIF22/KID to the spindle microtubules.
• Synonyms: C20orf129; CHICA; dJ616B8.3
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 79%; Horse: 79%

Reference Data

• Protein Families: Druggable Genome