Transmembrane protein 93 (EMC6) Rabbit Polyclonal Antibody

CAT#: TA335434

Rabbit Polyclonal Anti-TMEM93 Antibody

Product Images

WB Suggested Anti-TMEM93 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Jurkat cell lysate.EMC6 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TMEM93 Antibody: synthetic peptide directed towards the N terminal of human TMEM93. Synthetic peptide located within the following region: AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 12 kDa
• Gene Name: ER membrane protein complex subunit 6
• Database Link:
  NP_112588
  Entrez Gene 83460 Human
  UniProt ID Q9BV81
• Background: TMEM93 belongs to the TMEM93 family. It is a multi-pass membrane protein. The function of the TMEM93 protein remains unknown.
• Synonyms: TMEM93
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Transmembrane