B3GALNT1 Rabbit Polyclonal Antibody

SKU TA335426

Rabbit Polyclonal Anti-B3galnt1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-B3galnt1 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FTGYPLIENYSYRGFFHKNHISYQEYPFKVFPPYCSGLGYIMSGDLVPKI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group)
• Database Link:
  NP_149357
  O75752
• Background: B3galnt1 transfers N-acetylgalactosamine onto globotriaosylceramide.
• Synonyms: B3GALT3; beta3Gal-T3; galT3; Gb4Cer; GLCT3; GLOB; P; P1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Glycosphingolipid biosynthesis - globo series, Metabolic pathways