LDHAL6B Rabbit Polyclonal Antibody

SKU TA335425

Rabbit Polyclonal Anti-LDHAL6B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LDHAL6B Antibody: synthetic peptide directed towards the middle region of human LDHAL6B. Synthetic peptide located within the following region: SGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: lactate dehydrogenase A like 6B
• Database Link:
  NP_149972
  Q9BYZ2
• Background: The specific function of the protein remains unknown.
• Synonyms: LDH6B; LDHAL6; LDHL
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 79%; Bovine: 79%; Rabbit: 79%; Rat: 77%

Reference Data

• Protein Pathways: Cysteine and methionine metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism