TEX14 Rabbit Polyclonal Antibody

CAT#: TA335340

Rabbit Polyclonal Anti-TEX14 Antibody

Product Images

WB Suggested Anti-TEX14 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TEX14 Antibody: synthetic peptide directed towards the middle region of human TEX14. Synthetic peptide located within the following region: TPDGEYFYSSTAQENLALETSSPIEEDFEGIQGAFAQPQVSGEEKFQMRK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 164 kDa
• Gene Name: testis expressed 14, intercellular bridge forming factor
• Database Link:
  NP_938207
  Entrez Gene 56155 Human
  UniProt ID Q8IWB6
• Background: TEX14 belongs to the protein kinase superfamily. It contains 3 ANK repeats and 1 protein kinase domain. TEX14 is required for spermatogenesis and male fertility. It may be required for normal structure of the intercellular bridge that connects spermatocytes and spermatogonia. It has no protein kinase activity.
• Synonyms: CT113
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 86%; Pig: 85%; Horse: 82%; Dog: 79%; Rat: 79%; Rabbit: 79%

Reference Data

• Protein Families: Protein Kinase