TEX14 Rabbit Polyclonal Antibody

SKU TA335340

Rabbit Polyclonal Anti-TEX14 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TEX14 Antibody: synthetic peptide directed towards the middle region of human TEX14. Synthetic peptide located within the following region: TPDGEYFYSSTAQENLALETSSPIEEDFEGIQGAFAQPQVSGEEKFQMRK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 164 kDa
• Gene Name: testis expressed 14, intercellular bridge forming factor
• Database Link:
  NP_938207
  Q8IWB6
• Background: TEX14 belongs to the protein kinase superfamily. It contains 3 ANK repeats and 1 protein kinase domain. TEX14 is required for spermatogenesis and male fertility. It may be required for normal structure of the intercellular bridge that connects spermatocytes and spermatogonia. It has no protein kinase activity.
• Synonyms: CT113
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 86%; Pig: 85%; Horse: 82%; Dog: 79%; Rat: 79%; Rabbit: 79%

Reference Data

• Protein Families: Protein Kinase