TMEM195 (AGMO) Rabbit Polyclonal Antibody

SKU TA335315

Rabbit Polyclonal Anti-TMEM195 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM195 antibody: synthetic peptide directed towards the N terminal of human TMEM195. Synthetic peptide located within the following region: MKNPEAQQDVSVSQGFRMLFYTMKPSETSFQTLEEVPDYVKKATPFFISL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 51 kDa
• Gene Name: alkylglycerol monooxygenase
• Database Link:
  NP_001004320
  Q6ZNB7
• Background: TMEM195 belongs to the TMEM195 family.It is a multi-pass membrane protein. The function of the TMEM195 protein remains.
• Synonyms: TMEM195
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Bovine: 93%; Pig: 86%; Rabbit: 86%

Reference Data

• Protein Families: Transmembrane