ALG11 Rabbit Polyclonal Antibody

SKU TA335312

Rabbit Polyclonal Anti-ALG11 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ALG11 antibody: synthetic peptide directed towards the C terminal of human ALG11. Synthetic peptide located within the following region: LHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVIPHEGDITGFLAES
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 56 kDa
• Gene Name: ALG11, alpha-1,2-mannosyltransferase
• Database Link:
  NP_001004127
  Q2TAA5
• Background: The function remains unknown.
• Synonyms: CDG1P; GT8
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Mouse: 100%; Pig: 93%; Human: 93%; Guinea pig: 93%; Yeast: 92%; Bovine: 92%; Zebrafish: 91%; Dog: 86%; Rabbit: 86%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, N-Glycan biosynthesis