MCTP1 Rabbit Polyclonal Antibody

CAT#: TA335300

Rabbit Polyclonal Anti-MCTP1 Antibody

Product Images

WB Suggested Anti-MCTP1 Antibody Titration: 1 ug/ml; Positive Control: Hela cell lysate

• 

  Anti-MCTP1 antibody IHC staining of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

• 

  Rabbit Anti-MCTP1 Antibody; Paraffin Embedded Tissue: Human Spleen; Antibody Concentration: 5 ug/ml

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MCTP1 antibody: synthetic peptide directed towards the middle region of human MCTP1. Synthetic peptide located within the following region: LVWGINKFTKKLRSPYAIDNNELLDFLSRVPSDVQVVQYQELKPDPSHSP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 89 kDa
• Gene Name: multiple C2 and transmembrane domain containing 1
• Database Link:
  NP_001002796
  Entrez Gene 79772 Human
  UniProt ID Q6DN14
• Background: MCTP1 belongs to the MCTP family.It contains 3 C2 domains. MCTP1 is a multi-pass membrane protein. It binds calcium via the C2 domains in absence of phospholipids. The function of MCTP1 remains unknown.
• Synonyms: FLJ22344
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 86%; Zebrafish: 86%

Reference Data

• Protein Families: Transmembrane