ARMH4 Rabbit Polyclonal Antibody

SKU TA335285

Rabbit Polyclonal Anti-C14orf37 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C14orf37 antibody: synthetic peptide directed towards the N terminal of human C14orf37. Synthetic peptide located within the following region: EIAHVHAEKGQSDKMNTDDLENSSVTSKQTPQLVVSEDPMMMSAVPSATS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 84 kDa
• Gene Name: chromosome 14 open reading frame 37
• Database Link:
  NP_001001872
  Q86TY3
• Background: The functions of C14orf37 remain unknown.
• Synonyms: c14_5376
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 92%; Bovine: 92%; Dog: 85%; Pig: 85%; Horse: 77%

Reference Data

• Protein Families: Transmembrane