Pyrin (MEFV) Rabbit Polyclonal Antibody

SKU
TA335166
Rabbit Polyclonal Anti-MEFV Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MEFV antibody: synthetic peptide directed towards the N terminal of human MEFV. Synthetic peptide located within the following region: MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARP
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 86 kDa
Gene Name Mediterranean fever
Database Link
Background MEFV was identified as the gene that when mutated causes Mediterranean fever, a hereditary periodic fever syndrome. MEFV is expressed in granulocytes and myeloid bone marrow precursors. This gene encodes a protein, also known as pyrin or marenostrin, that is an important modulator of innate immunity. Mutations in this gene are associated with Mediterranean fever, a hereditary periodic fever syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms FMF; MEF; TRIM20
Note Immunogen Sequence Homology: Human: 100%; Horse: 85%; Pig: 77%; Rabbit: 77%
Reference Data
Protein Families Druggable Genome
Protein Pathways NOD-like receptor signaling pathway
Write Your Own Review
You're reviewing:Pyrin (MEFV) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.