Pyrin (MEFV) Rabbit Polyclonal Antibody

CAT#: TA335166

Rabbit Polyclonal Anti-MEFV Antibody

Product Images

WB Suggested Anti-MEFV Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HepG2 cell lysate

• 

  Host: Rabbit; Target Name: MEFV; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MEFV antibody: synthetic peptide directed towards the N terminal of human MEFV. Synthetic peptide located within the following region: MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 86 kDa
• Gene Name: Mediterranean fever
• Database Link:
  NP_000234
  Entrez Gene 4210 Human
  UniProt ID O15553
• Background: MEFV was identified as the gene that when mutated causes Mediterranean fever, a hereditary periodic fever syndrome. MEFV is expressed in granulocytes and myeloid bone marrow precursors. This gene encodes a protein, also known as pyrin or marenostrin, that is an important modulator of innate immunity. Mutations in this gene are associated with Mediterranean fever, a hereditary periodic fever syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: FMF; MEF; TRIM20
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 85%; Pig: 77%; Rabbit: 77%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: NOD-like receptor signaling pathway