Protein S (PROS1) Rabbit Polyclonal Antibody

SKU TA335142

Rabbit polyclonal Anti-PROS1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PROS1 antibody: synthetic peptide directed towards the middle region of human PROS1. Synthetic peptide located within the following region: MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 71 kDa
• Gene Name: protein S (alpha)
• Database Link:
  NP_000304
  P07225
• Background: PROS1 is an anticoagulant plasma protein; it is a cofactor to activated protein C in the degradation of coagulation factors Va and VIIIa. It helps to prevent coagulation and stimulating fibrinolysis.
• Synonyms: PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Complement and coagulation cascades