KLKBL4 (PRSS54) Rabbit Polyclonal Antibody

SKU TA334988

Rabbit Polyclonal Anti-PRSS54 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRSS54 antibody: synthetic peptide directed towards the C terminal of human PRSS54. Synthetic peptide located within the following region: EASVQPLYYDYYGGEVGEGRIFAGQNRLYQPEEIILVSFVLVFFCSSI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 44 kDa
• Gene Name: protease, serine 54
• Database Link:
  NP_001073961
  Q6PEW0
• Background: PRSS54 is a secreted protein. PRSS54 belongs to the peptidase S1 family, plasma kallikrein subfamily. It contains 1 peptidase S1 domain.
• Synonyms: CT67; KLKBL4
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 90%

Reference Data

• Protein Families: Druggable Genome