NARF Rabbit Polyclonal Antibody

CAT#: TA334973

Rabbit Polyclonal Anti-NARF Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human nuclear prelamin A recognition factor (NARF), transcript variant 1, 20 µg
    • 20 ug

USD 867.00


Transient overexpression lysate of nuclear prelamin A recognition factor (NARF), transcript variant 1
    • 100 ug

USD 665.00

Other products for "NARF"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NARF antibody: synthetic peptide directed towards the middle region of human NARF. Synthetic peptide located within the following region: RGQAQTPDGHADKALLRQMEGIYADIPVRRPESSAHVQELYQEWLEGINS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 45 kDa
Gene Name nuclear prelamin A recognition factor
Background Several proteins have been found to be prenylated and methylated at their carboxyl-terminal ends. Prenylation was initially believed to be important only for membrane attachment. However, another role for prenylation appears to be its importance in protein-protein interactions. The only nuclear proteins known to be prenylated in mammalian cells are prelamin A- and B-type lamins. Prelamin A is farnesylated and carboxymethylated on the cysteine residue of a carboxyl-terminal CaaX motif. This post-translationally modified cysteine residue is removed from prelamin A when it is endoproteolytically processed into mature lamin A. NARF binds to the prenylated prelamin A carboxyl-terminal tail domain. It may be a component of a prelamin A endoprotease complex. NARF is located in the nucleus, where it partially colocalizes with the nuclear lamina. It shares limited sequence similarity with iron-only bacterial hydrogenases.
Synonyms IOP2
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Pig: 92%; Mouse: 92%; Guinea pig: 92%; Horse: 85%; Bovine: 85%; Rabbit: 85%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.