SUNC1 (SUN3) Rabbit Polyclonal Antibody

SKU TA334963

Rabbit Polyclonal Anti-SUN3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SUN3 antibody: synthetic peptide directed towards the C terminal of human SUN3. Synthetic peptide located within the following region: IKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 40 kDa
• Gene Name: Sad1 and UNC84 domain containing 3
• Database Link:
  NP_001025190
  Q8TAQ9
• Background: SUN3 is a single-pass membrane protein. It contains 1 Unc84 (SUN) domain.
• Synonyms: SUNC1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Horse: 93%

Reference Data