C17orf97 Rabbit Polyclonal Antibody

CAT#: TA334942

Rabbit Polyclonal Anti-C17orf97 Antibody

Product Images

WB Suggested Anti-C17orf97 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C17orf97 antibody: synthetic peptide directed towards the N terminal of human LOC400566. Synthetic peptide located within the following region: VSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: chromosome 17 open reading frame 97
• Database Link:
  NP_001013694
  Entrez Gene 400566 Human
  UniProt ID Q6ZQX7
• Background: The exact function of LOC400566 remains unknown.
• Synonyms: CK20; LIAT1
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Pig: 86%; Horse: 86%