C6ORF173 (CENPW) Rabbit Polyclonal Antibody

SKU TA334935

Rabbit Polyclonal Anti-CENPW Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CENPW antibody: synthetic peptide directed towards the N terminal of human CENPW. Synthetic peptide located within the following region: ALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 10 kDa
• Gene Name: centromere protein W
• Database Link:
  NP_001012525
  Q5EE01
• Background: CENPW is up-regulated in many cancer tissues. It suggests that CENPW may act as an oncogene.
• Synonyms: C6orf173; CENP-W; CUG2
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 79%; Pig: 77%; Guinea pig: 77%

Reference Data