AQP12 (AQP12A) Rabbit Polyclonal Antibody

SKU TA334879

Rabbit Polyclonal Anti-AQP12A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AQP12A antibody is: synthetic peptide directed towards the C-terminal region of Human AQP12A. Synthetic peptide located within the following region: RLPHLFQRNLFYGQKNKYRAPRGKPAPASGDTQTPAKGSSVREPGRSGVE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: aquaporin 12A
• Database Link:
  NP_945349
  Q8IXF9
• Background: Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.
• Synonyms: AQP-12; AQP12; AQPX2
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 79%; Mouse: 79%; Rat: 77%; Bovine: 75%

Reference Data