AQP12 (AQP12A) Rabbit Polyclonal Antibody

SKU
TA334879
Rabbit Polyclonal Anti-AQP12A Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-AQP12A antibody is: synthetic peptide directed towards the C-terminal region of Human AQP12A. Synthetic peptide located within the following region: RLPHLFQRNLFYGQKNKYRAPRGKPAPASGDTQTPAKGSSVREPGRSGVE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 32 kDa
Gene Name aquaporin 12A
Database Link
Background Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.
Synonyms AQP-12; AQP12; AQPX2
Note Immunogen Sequence Homology: Human: 100%; Horse: 79%; Mouse: 79%; Rat: 77%; Bovine: 75%
Reference Data
Write Your Own Review
You're reviewing:AQP12 (AQP12A) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.