C17orf89 (NDUFAF8) Rabbit Polyclonal Antibody

SKU
TA334846
Rabbit Polyclonal Anti-C17orf89 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-C17orf89 antibody is: synthetic peptide directed towards the N-terminal region of Human C17orf89. Synthetic peptide located within the following region: VWGRVRSRLRAFPERLAACGAEAAAYGRCVQASTAPGGRLSKDFCAREFE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 8 kDa
Gene Name chromosome 17 open reading frame 89
Database Link
Background The function of this protein remains unknown.
Synonyms C17orf89
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%
Reference Data
Write Your Own Review
You're reviewing:C17orf89 (NDUFAF8) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.