RGS20 Rabbit Polyclonal Antibody

SKU TA334733

Rabbit Polyclonal Anti-RGS20 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RGS20 antibody: synthetic peptide directed towards the middle region of human RGS20. Synthetic peptide located within the following region: NAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 25 kDa
• Gene Name: regulator of G-protein signaling 20
• Database Link:
  NP_003693
  O76081
• Background: Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins are GTPase-activating proteins for Gi class G-alpha proteins. They accelerate transit through the cycle of GTP binding and hydrolysis and thereby accelerate signaling kinetics and termination.
• Synonyms: g(z)GAP; gz-GAP; RGSZ1; ZGAP1
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Rat: 93%; Rabbit: 93%; Dog: 92%; Bovine: 86%; Zebrafish: 86%; Mouse: 85%

Reference Data

• Protein Families: Druggable Genome