RGS19 Rabbit Polyclonal Antibody

SKU TA334728

Rabbit Polyclonal Anti-RGS19 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RGS19 antibody is: synthetic peptide directed towards the N-terminal region of Human RGS19. Synthetic peptide located within the following region: PTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSW
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 25 kDa
• Gene Name: regulator of G-protein signaling 19
• Database Link:
  NP_005864
  P49795
• Background: G proteins mediate a number of cellular processes. RGS19 belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling.
• Synonyms: GAIP; RGSGAIP
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Pig: 92%; Bovine: 92%; Guinea pig: 92%; Dog: 85%

Reference Data

• Protein Families: Druggable Genome