Carboxypeptidase B (CPB1) Rabbit Polyclonal Antibody
Frequently bought together (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "Carboxypeptidase B"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CPB1 antibody: synthetic peptide directed towards the N terminal of human CPB1. Synthetic peptide located within the following region: SRVRATGHSYEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIYL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 35 kDa |
Gene Name | carboxypeptidase B1 |
Database Link | |
Background | The specific function of the protein remains unknown.Three different procarboxypeptidases A and two different procarboxypeptidases B have been isolated. The B1 and B2 forms differ from each other mainly in isoelectric point. Carboxypeptidase B1 is a highly tissue-specific protein and is a useful serum marker for acute pancreatitis and dysfunction of pancreatic transplants. It is not elevated in pancreatic carcinoma. |
Synonyms | CPB; PASP; PCPB |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Horse: 85%; Bovine: 85%; Rabbit: 85% |
Reference Data | |
Protein Families | Druggable Genome, Protease, Secreted Protein |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.