Carboxypeptidase B (CPB1) Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CPB1 antibody: synthetic peptide directed towards the N terminal of human CPB1. Synthetic peptide located within the following region: SRVRATGHSYEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIYL |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 35 kDa |
Gene Name | carboxypeptidase B1 |
Database Link | |
Background | The specific function of the protein remains unknown.Three different procarboxypeptidases A and two different procarboxypeptidases B have been isolated. The B1 and B2 forms differ from each other mainly in isoelectric point. Carboxypeptidase B1 is a highly tissue-specific protein and is a useful serum marker for acute pancreatitis and dysfunction of pancreatic transplants. It is not elevated in pancreatic carcinoma. |
Synonyms | CPB; PASP; PCPB |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Horse: 85%; Bovine: 85%; Rabbit: 85% |
Reference Data | |
Protein Families | Druggable Genome, Protease, Secreted Protein |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.