SLC26A5 Rabbit Polyclonal Antibody

CAT#: TA334633

Rabbit Polyclonal Anti-SLC26A5 Antibody

Product Images

WB Suggested Antibody Titration: 2.5 ug/ml; Positive Control: HepG2

• 

  Human Lung

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC26A5 antibody: synthetic peptide directed towards the middle region of human SLC26A5. Synthetic peptide located within the following region: FSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 81 kDa
• Gene Name: solute carrier family 26 member 5
• Database Link:
  NP_945350
  Entrez Gene 375611 Human
  UniProt ID P58743
• Background: SLC26A5 is a member of the SLC26A/SulP transporter family. SLC26A5 is specifically expressed in outer hair cells (OHCs) of the cochlea and is essential in auditory processing. Intracellular anions are thought to act as extrinsic voltage sensors, which bind to this protein and trigger the conformational changes required for rapid length changes in OHCs. Mutations in its gene have been associated with non-syndromic hearing loss.This gene is a member of the SLC26A/SulP transporter family. It encodes a protein that is specifically expressed in outer hair cells (OHCs) of the cochlea and is essential in auditory processing. Intracellular anions are thought to act as extrinsic voltage sensors, which bind to this protein and trigger the conformational changes required for rapid length changes in OHCs. Mutations in this gene have been associated with non-syndromic hearing loss. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Synonyms: DFNB61; PRES
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane