SLC6A15 Rabbit Polyclonal Antibody

CAT#: TA334627

Rabbit Polyclonal Anti-Slc6a15 Antibody

Product Images

WB Suggested Anti-Slc6a15 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Slc6a15 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VEDYRLVYDIIQKVKEEEFAVLHLNACQIEDELNKAVQGTGLAFIAFTEA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 82 kDa
• Gene Name: solute carrier family 6 member 15
• Database Link:
  NP_877499
  Entrez Gene 103098 Mouse
  UniProt ID Q9H2J7
• Background: Slc6a15 functions as a sodium-dependent neutral amino acid transporter. It exhibits preference for methionine and for the branched-chain amino acids, particulary leucine, valine and isoleucine. It mediates the saturable, pH-sensitive and electrogenic cotransport of proline and sodium ions with a stoichiometry of 1:1. Slc6a15 may have a role as transporter for neurotransmitter precursors into neurons. In contrast to other members of the neurotransmitter transporter family, Slc6a15 does not appear to be chloride-dependent.
• Synonyms: hv7-3; NTT73; SBAT1; V7-3
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Zebrafish: 86%; Rabbit: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane