SLC15A4 Rabbit Polyclonal Antibody

SKU TA334601

Rabbit Polyclonal Anti-SLC15A4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC15A4 antibody: synthetic peptide directed towards the middle region of human SLC15A4. Synthetic peptide located within the following region: GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 62 kDa
• Gene Name: solute carrier family 15 member 4
• Database Link:
  NP_663623
  Q8N697
• Background: SLC15A4 is the proton oligopeptide cotransporter. It transports free histidine and certain di- and tripeptides.
• Synonyms: FP12591; PHT1; PTR4
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%

Reference Data