Tropomodulin 3 (TMOD3) Rabbit Polyclonal Antibody

SKU
TA334549
Rabbit Polyclonal Anti-TMOD3 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TMOD3 antibody: synthetic peptide directed towards the middle region of human TMOD3. Synthetic peptide located within the following region: ITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRT
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 39 kDa
Gene Name tropomodulin 3
Database Link
Background TMOD3 belongs to the tropomodulin family. It blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton. This gene is a necessary element in receptor tyrosine kinase pathways, possibly as a tyrosine phosphorylation target. It is involved in regulation of RAF in the MAPK pathway and may also play a role in a MAPK-independent pathway.
Synonyms UTMOD
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Zebrafish: 86%
Reference Data
Write Your Own Review
You're reviewing:Tropomodulin 3 (TMOD3) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.