RTDR1 (RSPH14) Rabbit Polyclonal Antibody

SKU TA334537

Rabbit Polyclonal Anti-RTDR1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RTDR1 antibody: synthetic peptide directed towards the middle region of human RTDR1. Synthetic peptide located within the following region: IARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 38 kDa
• Gene Name: radial spoke head 14 homolog
• Database Link:
  NP_055248
  Q9UHP6
• Background: The specific function of the protein remains unknown.This gene encodes a protein with no known function but with slight similarity to a yeast vacuolar protein. The gene is located in a region deleted in pediatric rhabdoid tumors of the brain, kidney and soft tissues, but mutations in this gene have not been associated with the disease.
• Synonyms: RTDR1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 79%; Bovine: 79%; Guinea pig: 79%; Horse: 77%

Reference Data

• Protein Families: Druggable Genome