Pescadillo (PES1) Rabbit Polyclonal Antibody

CAT#: TA334509

Rabbit Polyclonal Anti-PES1 Antibody

Product Images

WB Suggested Anti-PES1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Hela cell lysatePES1 is supported by BioGPS gene expression data to be expressed in HeLa

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PES1 antibody: synthetic peptide directed towards the C terminal of human PES1. Synthetic peptide located within the following region: KKREKYLYQKIMFGKRRKIREANKLAEKRKAHDEAVRSEKKAKKARPE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: pescadillo ribosomal biogenesis factor 1
• Database Link:
  NP_055118
  Entrez Gene 23481 Human
  UniProt ID O00541
• Background: PES1 is abnormally elevated in malignant tumors of astrocytic origin. It is a strongly conserved gene containing a BRCT domain that is essential for the activity of this gene product. The gene plays a crucial role in cell proliferation and may be necessary for oncogenic transformation and tumor progression.This gene encodes a protein that is abnormally elevated in malignant tumors of astrocytic origin. It is a strongly conserved gene containing a BRCT domain that is essential for the activity of this gene product. The gene plays a crucial role in cell proliferation and may be necessary for oncogenic transformation and tumor progression. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: PES
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Guinea pig: 93%; Rabbit: 86%; Zebrafish: 86%