GLUD2 Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GLUD2 antibody: synthetic peptide directed towards the N terminal of human GLUD2. Synthetic peptide located within the following region: EGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSF |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 61 kDa |
Gene Name | glutamate dehydrogenase 2 |
Database Link | |
Background | Glutamate dehydrogenase (EC 1.4.1.3) catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate using NAD and/or NADP as cofactors. |
Synonyms | GDH2; GLUDP1 |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 92%; Dog: 85%; Pig: 85%; Horse: 85%; Mouse: 85%; Sheep: 77%; Bovine: 77% |
Reference Data | |
Protein Pathways | Alanine, Arginine and proline metabolism, aspartate and glutamate metabolism, D-Glutamine and D-glutamate metabolism, Metabolic pathways, Nitrogen metabolism |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.