CENPI Rabbit Polyclonal Antibody

CAT#: TA334413

Rabbit Polyclonal Anti-CENPI Antibody

Product Images

WB Suggested Anti-CENPI Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: MCF7 cell lysateCENPI is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells

• 

  Sample Type: DNA/ACA;

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: WB, IF
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CENPI antibody: synthetic peptide directed towards the N terminal of human CENPI. Synthetic peptide located within the following region: SPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 87 kDa
• Gene Name: centromere protein I
• Database Link:
  NP_006724
  Entrez Gene 2491 Human
  UniProt ID Q92674
• Background: CENPI is involved in the response of gonadal tissues to follicle-stimulating hormone. The gene encoding CENPI is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis. The product of this gene is involved in the response of gonadal tissues to follicle-stimulating hormone. This gene is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis.
• Synonyms: CENP-I; FSHPRH1; LRPR1
• Note: Immunogen Sequence Homology: Human: 100%