PSMB11 Rabbit Polyclonal Antibody

SKU TA334356

Rabbit Polyclonal Anti-PSMB11 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PSMB11 antibody is: synthetic peptide directed towards the C-terminal region of Human PSMB11. Synthetic peptide located within the following region: HVRESGWEHVSRSDACVLYVELQKLLEPEPEEDASHAHPEPATAHRAAED
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 33 kDa
• Gene Name: proteasome subunit beta 11
• Database Link:
  NP_001093250
  A5LHX3
• Background: Proteasomes generate peptides that are presented by major histocompatibility complex (MHC) I molecules to other cells of the immune system. Proteolysis is conducted by 20S proteasomes, complexes of 28 subunits arranged as a cylinder in 4 heteroheptameric rings: alpha-1 to -7, beta-1 to -7, beta-1 to -7, and alpha-1 to -7. The catalytic subunits are beta-1, beta-2), and beta-5 (PSMB5; MIM 600306). Three additional subunits, beta-1i, beta-2i, and beta-5i, are induced by gamma-interferon and are preferentially incorporated into proteasomes to make immunoproteasomes. PSMB11, or beta-5t, is a catalytic subunit expressed exclusively in cortical thymic epithelial cells .
• Synonyms: BETA5T
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 83%

Reference Data

• Protein Pathways: Proteasome