Neurabin 1 (PPP1R9A) Rabbit Polyclonal Antibody

CAT#: TA334354

Rabbit Polyclonal Anti-PPP1R9A Antibody

Product Images

Host: Rabbit; Target Name: PPP1R9A; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PPP1R9A antibody is: synthetic peptide directed towards the N-terminal region of Human PPP1R9A. Synthetic peptide located within the following region: GERTTLRSASPHRNAYRTEFQALKSTFDKPKSDGEQKTKEGEGSQQSRGR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 151 kDa
• Gene Name: protein phosphatase 1 regulatory subunit 9A
• Database Link:
  NP_001159632
  Entrez Gene 55607 Human
  UniProt ID Q9ULJ8
• Background: This gene is imprinted, and located in a cluster of imprinted genes on chromosome 7q12. This gene is transcribed in both neuronal and multiple embryonic tissues, and it is maternally expressed mainly in embryonic skeletal muscle tissues and biallelically expressed in other embryonic tissues. The protein encoded by this gene includes a PDZ domain and a sterile alpha motif (SAM). It is a regulatory subunit of protein phosphatase I, and controls actin cytoskeleton reorganization. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Synonyms: Neurabin-I; NRB1; NRBI
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Rabbit: 92%

Reference Data

• Protein Families: Druggable Genome