PPFIBP2 Rabbit Polyclonal Antibody

SKU TA334352

Rabbit Polyclonal Anti-PPFIBP2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PPFIBP2 antibody is: synthetic peptide directed towards the C-terminal region of Human PPFIBP2. Synthetic peptide located within the following region: LAMLLNIPPQKTLLRRHLTTKFNALIGPEAEQEKREKMASPAYTPLTTTA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 98 kDa
• Gene Name: PPFIA binding protein 2
• Database Link:
  NP_003612
  Q8ND30
• Background: This gene encodes a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. The encoded protein is a beta liprin and plays a role in axon guidance and neuronal synapse development by recruiting LAR protein-tyrosine phosphatases to the plasma membrane. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Synonyms: Cclp1
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 92%

Reference Data