PATL2 Rabbit Polyclonal Antibody

SKU TA334346

Rabbit Polyclonal Anti-PATL2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PATL2 antibody is: synthetic peptide directed towards the C-terminal region of Human PATL2. Synthetic peptide located within the following region: LQLLEIEEGWKYRPPPPCFSEQQSNQVEKLFQTLKTQEQNNLEEAADGFL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 59 kDa
• Gene Name: PAT1 homolog 2
• Database Link:
  NP_001138584
  C9JE40
• Background: PATL2 is a RNA-binding protein that acts as a translational repressor.
• Synonyms: hPat1a; Pat1a
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Dog: 86%; Horse: 86%; Pig: 79%; Guinea pig: 79%; Bovine: 77%

Reference Data