KIF24 Rabbit Polyclonal Antibody

SKU TA334316

Rabbit Polyclonal Anti-KIF24 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KIF24 antibody is: synthetic peptide directed towards the N-terminal region of Human KIF24. Synthetic peptide located within the following region: IRQNTSEKQNPWTEMEKIRVCVRKRPLGMREVRRGEINIITVEDKETLLV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 140 kDa
• Gene Name: kinesin family member 24
• Database Link:
  NP_919289
  Q5T7B8
• Background: Kinesins, such as KIF24, are microtubule-dependent ATPases that function as molecular motors. They play important roles in intracellular vesicle transport and cell division.
• Synonyms: bA571F15.4; C9orf48
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 92%; Rabbit: 77%

Reference Data

• Protein Families: Druggable Genome