PDZD6 (INTU) Rabbit Polyclonal Antibody

SKU TA334312

Rabbit Polyclonal Anti-INTU Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-INTU antibody is: synthetic peptide directed towards the C-terminal region of Human INTU. Synthetic peptide located within the following region: TLEEVAQLSGSIHPQLIKNFHQCCLSIRAVFQQTLVEEKKKGLNSGDHSD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 104 kDa
• Gene Name: inturned planar cell polarity protein
• Database Link:
  NP_056508
  Q9ULD6
• Background: INTU plays a key role in ciliogenesis and embryonic development. INTU is a regulator of cilia formation by controlling the organization of the apical actin cytoskeleton and the positioning of the basal bodies at the apical cell surface, which in turn is essential for the normal orientation of elongating ciliary microtubules. It plays a key role in definition of cell polarity via its role in ciliogenesis but not via conversion extension and has an indirect effect on hedgehog signaling.
• Synonyms: INT; PDZD6; PDZK6
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 79%

Reference Data