GPR135 Rabbit Polyclonal Antibody

CAT#: TA334305

Rabbit Polyclonal Anti-GPR135 Antibody

Product Images

Host: Rabbit; Target Name: GPR135; Sample Tissue: HT1080 Whole Cell lysates; Antibody Dilution: 1.0ug/mL

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPR135 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR135. Synthetic peptide located within the following region: SSSNPASGVAGDVAMWARKNPVVLFCREGPPEPVTAVTKQPKSEAGDTSL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: G protein-coupled receptor 135
• Database Link:
  NP_072093
  Entrez Gene 64582 Human
  UniProt ID Q8IZ08
• Background: GPR135 is an orphan receptor.
• Synonyms: HUMNPIIY20
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane