SLC17A2 Rabbit Polyclonal Antibody

SKU
TA334280
Rabbit Polyclonal Anti-SLC17A2 Antibody
$585.00
5 Days*
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SLC17A2 antibody: synthetic peptide directed towards the middle region of human SLC17A2. Synthetic peptide located within the following region: VIYDDPMHHPCISVREKEHILSSLAQQPSSPGRAVPIKAMVTCLPLWAIF
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 48 kDa
Gene Name solute carrier family 17 member 2
Database Link
Background SLC17A2 is a member of the solute carrier family.
Synonyms NPT3
Note Immunogen Sequence Homology: Human: 100%; Rat: 92%; Pig: 91%; Guinea pig: 91%; Mouse: 85%; Bovine: 85%; Horse: 77%
Reference Data
Protein Families Transmembrane
Write Your Own Review
You're reviewing:SLC17A2 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.