Asialoglycoprotein Receptor 1 (ASGR1) Rabbit Polyclonal Antibody

SKU TA334279

Rabbit Polyclonal Anti-ASGR1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ASGR1 antibody: synthetic peptide directed towards the N terminal of human ASGR1. Synthetic peptide located within the following region: RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 33 kDa
• Gene Name: asialoglycoprotein receptor 1
• Database Link:
  NP_001662
  P07306
• Background: ASGR1 encodes for a cell surface receptor binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface.
• Synonyms: ASGPR; ASGPR1; CLEC4H1; HL-1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 92%; Guinea pig: 92%; Mouse: 91%; Horse: 86%; Bovine: 85%; Yeast: 75%

Reference Data

• Protein Families: Druggable Genome, Transmembrane