CBF1 interacting corepressor (CIR1) Rabbit Polyclonal Antibody

CAT#: TA334244

Rabbit Polyclonal Anti-CIR1 Antibody

Product Images

Host: Rabbit; Target Name: CIR1; Sample Tissue: Pancreas Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CIR1 antibody is: synthetic peptide directed towards the middle region of Human CIR1. Synthetic peptide located within the following region: GRNLTANDPSQEYVASEGEEDPEVEFLKSLTTKQKQKLLRKLDRLEKKKK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: corepressor interacting with RBPJ, 1
• Database Link:
  NP_004873
  Entrez Gene 9541 Human
  UniProt ID Q86X95
• Background: CIR may modulate splice site selection during alternative splicing of pre-mRNAs. CIR regulates transcription and acts as corepressor for RBPSUH by recruiting RBPSUH to the Sin3-histone deacetylase complex (HDAC). CIR is also required for RBPSUH-mediated repression of transcription.
• Synonyms: CIR
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Notch signaling pathway