ZNF96 (ZSCAN12) Rabbit Polyclonal Antibody

SKU TA334231

Rabbit Polyclonal Anti-ZSCAN12 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZSCAN12 antibody: synthetic peptide directed towards the middle region of human ZSCAN12. Synthetic peptide located within the following region: RLRKEGEPSMSLQSMKAQPKYESPELESQQEQVLDVETGNEYGNLKQEVS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 66 kDa
• Gene Name: zinc finger and SCAN domain containing 12
• Database Link:
  NP_001034732
• Background: The exact function of this protein remains unknown.
• Synonyms: dJ29K1.2; KIAA0426; ZFP96; zinc finger and SCAN domain containing 12; zinc finger protein 96; zinc finger protein 305; ZNF29K1; ZNF96; ZNF305; ZSCAN12
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Rat: 85%; Mouse: 85%; Rabbit: 85%; Guinea pig: 79%

Reference Data

• Protein Families: Transcription Factors