ZIC5 Rabbit Polyclonal Antibody

SKU TA334216

Rabbit Polyclonal Anti-ZIC5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZIC5 antibody: synthetic peptide directed towards the N terminal of human ZIC5. Synthetic peptide located within the following region: MEPPLSKRNPPALRLADLATAQVQPLQNMTGFPALAGPPAHSQLRAAVAH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 66 kDa
• Gene Name: Zic family member 5
• Database Link:
  NP_149123
  Q96T25
• Background: ZIon Channel5 is a member of the ZIon Channel family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to a gene encoding zinc finger protein of the cerebellum 2, a related family member on chromosome 13. This gene encodes a protein of unknown function.
• Synonyms: Drosophila); OTTHUMP00000040732; Zic family member 5 (odd-paired homolog; zinc family member 5 protein; zinc finger protein of the cerebellum 5
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 92%; Guinea pig: 86%; Zebrafish: 79%

Reference Data

• Protein Families: Transcription Factors