Pirin (PIR) Rabbit Polyclonal Antibody

CAT#: TA334214

Rabbit Polyclonal Anti-PIR Antibody

Product Images

WB Suggested Anti-PIR Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate

• 

  Human Lung

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PIR antibody: synthetic peptide directed towards the C terminal of human PIR. Synthetic peptide located within the following region: SHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: pirin
• Database Link:
  NP_003653
  Entrez Gene 8544 Human
  UniProt ID O00625
• Background: PIR is a member of the cupin superfamily. The protein is an Fe(II)-containing nuclear protein expressed in all tissues of the body and concentrated within dot-like subnuclear structures. Interactions with nuclear factor I/CCAAT box transcription factor as well as B cell lymphoma 3-encoded oncoprotein suggest the protein may act as a transcriptional cofactor and be involved in the regulation of DNA transcription and replication.This gene encodes a member of the cupin superfamily. The encoded protein is an Fe(II)-containing nuclear protein expressed in all tissues of the body and concentrated within dot-like subnuclear structures. Interactions with nuclear factor I/CCAAT box transcription factor as well as B cell lymphoma 3-encoded oncoprotein suggest the encoded protein may act as a transcriptional cofactor and be involved in the regulation of DNA transcription and replication. Alternatively spliced transcript variants have been described.
• Synonyms: OTTHUMP00000022961; OTTHUMP00000022962; pirin; pirin (iron-binding nuclear protein)
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%

Reference Data

• Protein Families: Transcription Factors