HPS2 (AP3B1) Rabbit Polyclonal Antibody

SKU TA334212

Rabbit Polyclonal Anti-Ap3b1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Ap3b1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 121 kDa
• Gene Name: adaptor related protein complex 3 beta 1 subunit
• Database Link:
  NP_003655
  O00203
• Background: The function of Ap3b1 remains unknown.
• Synonyms: ADTB3; ADTB3A; HPS; HPS2; PE
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Mouse: 92%; Dog: 79%

Reference Data

• Protein Pathways: Lysosome