ZNF703 Rabbit Polyclonal Antibody

SKU TA334209

Rabbit Polyclonal Anti-ZNF703 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF703 antibody: synthetic peptide directed towards the C terminal of human ZNF703. Synthetic peptide located within the following region: LSRYHPYGKSHLSTAGGLAVPSLPTAGPYYSPYALYGQRLASASALGYQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 58 kDa
• Gene Name: zinc finger protein 703
• Database Link:
  NP_079345
  Q9H7S9
• Background: ZNF703 belongs to the Elbow/Noc family. It contains 1 C2H2-type zinc finger.ZNF703 may function as a transcriptional repressor.
• Synonyms: NLZ1; ZEPPO1; ZNF503L; ZPO1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 88%; Rabbit: 88%; Zebrafish: 88%

Reference Data