Claudin 8 (CLDN8) Rabbit Polyclonal Antibody

SKU TA334199

Rabbit Polyclonal Anti-CLDN8 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CLDN8 antibody: synthetic peptide directed towards the C terminal of human CLDN8. Synthetic peptide located within the following region: IVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 25 kDa
• Gene Name: claudin 8
• Database Link:
  NP_955360
  P56748
• Background: CLDN8, clustered with CLDN17 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.
• Synonyms: HEL-S-79
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 85%; Bovine: 85%; Rabbit: 85%; Dog: 77%; Pig: 77%; Rat: 77%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction