NRAMP1 (SLC11A1) Rabbit Polyclonal Antibody

CAT#: TA334161

Rabbit Polyclonal Anti-SLC11A1 Antibody

Product Images

Host: Rabbit; Target Name: SLC11A1; Sample Tissue: HT1080 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC11A1 Antibody is: synthetic peptide directed towards the middle region of Human SLC11A1. Synthetic peptide located within the following region: GYEYVVARPEQGALLRGLFLPSCPGCGHPELLQAVGIVGAIIMPHNIYLH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: solute carrier family 11 member 1
• Database Link:
  NP_000569
  Entrez Gene 6556 Human
  UniProt ID P49279
• Background: SLC11A1 is a divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Macrophage-specific membrane transport function. It controls natural resistance to infection with intracellular parasites. Pathogen resistance involves sequestration of Fe2+ and Mn2+, cofactors of both prokaryotic and eukaryotic catalases and superoxide dismutases, not only to protect the macrophage against its own generation of reactive oxygen species, but to deny the cations to the pathogen for synthesis of its protective enzymes.
• Synonyms: LSH; NRAMP; NRAMP1
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Rat: 86%; Goat: 86%; Horse: 86%; Sheep: 86%; Bovine: 86%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Lysosome