RPS16 Rabbit Polyclonal Antibody

CAT#: TA334137

Rabbit Polyclonal Anti-RPS16 Antibody

Product Images

WB Suggested Anti-RPS16 Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysate

• 

  Host: Rabbit; Target Name: RPS16; Sample Tissue: Jurkat cell lysates; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide ; Primary Antibody Concentration:2.5 ug/ml; Peptide Concentration: 4.0ug/ml; Lysate Quantity: 25ug/lane; Gel Concen

• 

  Host: Rabbit; Target Name: RPS16; Sample Tissue: Jurkat; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide ; Primary Antibody Concentration:2.5ug/mL; Peptide Concentration: 2.0ug/mL; Lysate Quantity: 25ug/lane; Gel Concentration: 10-20%

• 

  Human Lung

• 

  Rabbit Anti-RPS16 Antibody; Paraffin Embedded Tissue: Human alveolar cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Show all 5 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RPS16 Antibody: synthetic peptide directed towards the N terminal of human RPS16. Synthetic peptide located within the following region: SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: ribosomal protein S16
• Database Link:
  NP_001011
  Entrez Gene 6217 Human
  UniProt ID P62249
• Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPS16 is a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S9P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
• Synonyms: S16
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Pathways: Ribosome