Germany
Japan
United Kingdom
China
SLC25A4 Rabbit Polyclonal Antibody
Product Images
Frequently bought together (2)
Transient overexpression lysate of solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 (SLC25A4), nuclear gene encoding mitochondrial protein
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "SLC25A4"
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommended Dilution | WB |
| Reactivities | Human, Rat |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-SLC25A4 Antibody: synthetic peptide directed towards the N terminal of human SLC25A4. Synthetic peptide located within the following region: LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 33 kDa |
| Gene Name | solute carrier family 25 member 4 |
| Database Link | |
| Background | This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Mutations in this gene have been shown to result in autosomal dominant progressive external opthalmoplegia and familial hypertrophic cardiomyopathy. |
| Synonyms | 1; AAC1; ANT; ANT 1; ANT1; MTDPS12; PEO2; PEO3; T1 |
| Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 86% |
| Reference Data | |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Calcium signaling pathway, Huntington's disease, Parkinson's disease |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.