IYD Rabbit Polyclonal Antibody

SKU TA334075

Rabbit Polyclonal Anti-IYD Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-IYD Antibody is: synthetic peptide directed towards the N-terminal region of Human IYD. Synthetic peptide located within the following region: NADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 27 kDa
• Gene Name: iodotyrosine deiodinase
• Database Link:
  NP_001158167
  Q6PHW0
• Background: This gene encodes an enzyme that catalyzes the oxidative NADPH-dependent deiodination of mono- and diiodotyrosine, which are the halogenated byproducts of thyroid hormone production. The N-terminus of the protein functions as a membrane anchor. Mutations in this gene cause congenital hypothyroidism due to dyshormonogenesis type 4, which is also referred to as deiodinase deficiency, or iodotyrosine dehalogenase deficiency, or thyroid hormonogenesis type 4.
• Synonyms: C6orf71; DEHAL1; IYD-1; TDH4
• Note: Immunogen sequence homology: Human: 100%; Rat: 86%; Dog: 79%; Rabbit: 79%; Bovine: 77%

Reference Data

• Protein Families: Transmembrane