MCAF2 (ATF7IP2) Rabbit Polyclonal Antibody

SKU TA334065

Rabbit Polyclonal Anti-ATF7IP2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ATF7IP2 Antibody is: synthetic peptide directed towards the N-terminal region of Human ATF7IP2. Synthetic peptide located within the following region: EEIVHSETKLEQVVCSYQKPSRTTESPSRVFTEEAKDSLNTSENDSEHQT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 59 kDa
• Gene Name: activating transcription factor 7 interacting protein 2
• Database Link:
  NP_001243089
  Q5U623
• Background: ATF7IP2 is a recruiter that couples transcriptional factors to general transcription apparatus and thereby modulates transcription regulation and chromatin formation. It can both act as an activator or a repressor depending on the context. ATF7IP2 mediates MBD1-dependent transcriptional repression, probably by recruiting complexes containing SETDB1. The complex formed with MBD1 and SETDB1 represses transcription and probably couples DNA methylation and histone H3 'Lys-9' trimethylation (H3K9me3) activity.
• Synonyms: MCAF2
• Note: Immunogen sequence homology: Human: 100%

Reference Data